Rond De Serviettes Personnalisées

  • Les serviettes en papier personnalisées avec votre photo
    Personnalisez vos serviettes de table avec une photo et du texte !Pour vos repas de famille, anniversaires, mariages, nous imprimons…
  • Metaltex 736612 Lot de 4 ronds de serviette en bois - Coloris aléatoire
    4 ronds de serviette de couleur
  • Aubry-Cadoret 1890 Rond de serviette renard (Petit Prince)
    Lessentiel est invisible pour les yeux a dit le Renard au Petit Prince. Pourtant on ne peut que remarquer ce…
  • MGI DEVELOPPEMENT Artisanat Francais Traditionnel, Lot DE 12 Ronds de Serviette en Bois Brut Made in France, Jura (à Laisser Brut ou à Personnaliser Vous-même)
    Artisanat francais traditionnel, Lot de 8 ronds de serviette en bois brut made in France, Jura (à laisser brut ou…
  • Amikado Serviette cuir 1 soufflet personnalisée
    Cette élégante serviette en cuir vous permettra de transporter vos documents et accessoires de travail ou même votre tablette. Livré…
  • MGI DEVELOPPEMENT Artisanat Francais Traditionnel, Lot de 8 Ronds de Serviette en Bois Brut Made in France, Jura (à Laisser Brut ou à Personnaliser Vous-même)
    Artisanat francais traditionnel, Lot de 8 ronds de serviette en bois brut made in France, Jura (à laisser brut ou…
  • Amikado Serviette ordinateur 13' personnalisée
    Cette sacoche en cuir vous permettra de transporter un ordinateur de petite taille (13 pouces maximum) ou votre tablette, et…
  • COSMOPLAST Lot de 6 Porte-Serviettes en Plastique
    ROND SERVIETTES PAR 6 Idéal pour identifier chaque serviette de table!
  • Amikado Serviette ordinateur 17' personnalisée
    Cette sacoche en cuir vous permettra de transporter un ordinateur de 17 pouces maximum et des documents : un accessoire…
  • iDesign 90330EU Realwood Ronds de Serviette (Set de 4) - Blanc/Finition Bois Clair, Métal, White/Light Wood Finish
    Lot de 4 ronds de serviette Pour maintenir serviettes ou nappes Idéal pour les déjeuners, mariages, dîners, pique-niques, et vacances…
  • Amikado Serviette cuir 2 soufflets personnalisée
    Cette élégante serviette en cuir et ses deux compartiments vous permettra de transporter vos documents et accessoires de travail ou…
  • AILINDA Ronds de serviette en bois rustique faits main pour décoration de table 12pc
    Fabriqué en bois 100 % naturel. Construction en bois massif utilisant les meilleurs bois, ces anneaux de serviette sont capables…
  • Xò by Metalform Design esclusiva Viadurini Valve et support pour porte-serviettes chauffant rond avec joint torique Lily
    Valve et support pour porte-serviettes chauffant rond avec joint torique Lily Lily est un article qui comprend une valve et…
  • Duo de serviettes Mr & Mrs personnalisables par deux prénoms - Cadeau couple
    Un duo de serviettes pour lui et pour elle, avec une bouche et une moustache ainsi que le prénom de…
  • Demeure et jardin Rond de Serviette Fleur de bronze
    Set de 4 ronds de serviette en perles composant une fleur de couleur bronze avec 4 fils breloques. Riche travail…
  • Guzzini, Lot De 6 Ronds De Serviettes, 7,7 x 1,5 x h5,5 cm
    Dimension: 7,7 x 1,5 x h5,5 cm Collection: Love - Designer: Setsu&Shinobu Ito Lavable au lave-vaisselle à max. 65°C -…
  • CRISTINA ONDYNA PORTE SERVIETTE ANNEAU ROND GRAND HOTEL NOIR - CRISTINA ONDYNA TE20713
    PORTE SERVIETTE ANNEAU ROND GRAND HOTEL NOIR - CRISTINA ONDYNA TE20713
  • A di Alessi - AKK10 M - Girotondo - Rond de Serviette Ajouré en Acier Brillant - Homme
    25 unités de cet article soldées à partir du 8 janvier 2020 8h (uniquement sur les unités vendues et expédiées…
  • CRISTINA ONDYNA PORTE SERVIETTE ANNEAU ROND GRAND HOTEL CHROME - CRISTINA ONDYNA TE20751
    PORTE SERVIETTE ANNEAU ROND GRAND HOTEL CHROME - CRISTINA ONDYNA TE20751
  • ROND DE SERVIETTE PERSONNALISÉ PRÉNOM
    Rond de serviette prénom à personnaliser vous même Nous vous contactons pour connaître vos prénoms, surnoms ou noms personnalisés Expédié…
  • CRISTINA ONDYNA PORTE SERVIETTE ANNEAU ROND GRAND HOTEL BLANC - CRISTINA ONDYNA TE20724
    PORTE SERVIETTE ANNEAU ROND GRAND HOTEL BLANC - CRISTINA ONDYNA TE20724
  • HappyBulle Rond de Serviette Bois Gravé
    Gravez le prénom d’un membre de votre famille sur ce rond de serviette en bambou pour ne plus jamais les…
  • Pavelinni Rond à Serviette Stripe Vintage avec Velcro Ø40-60mm Disponible en 7 Couleurs Lot de 10 Pièces
    - Ø 4-6 cm - Terminez la présentation de votre table avec ce rond de serviette- Fermeture avec velcro
  • Unique 5 Rond de serviette en argent
  • Unisan Sanindusa - Porte-serviettes rond PLAN Sanindusa
    Porte-serviettes rond pour salle de bains. 19 cm de diamètre.
  • Unisan Sanindusa - Porte-serviettes rond ADVANCE Sanindusa
    Porte-serviettes rond pour salle de bains. 18,6 x 18,5 x 6 cm.
  • Unisan Sanindusa - Porte-serviettes rond LUXE Sanindusa
    Porte-serviettes rond pour salle de bains. 22,8 x 6,5 cm.
  • Amikado Coffret timbale et rond de serviette tonneau
    Un coffret de la gamme "tonneau" composé d'une timbale et d'un rond de serviette en métal argenté. Ces magnifiques pièces…
  • Amikado Coffret timbale et rond de serviette design
    Un coffret design composé d'une timbale et d'un rond de serviette en métal argenté. Ces pièces d'orfèvrerie fabriquées artisanalement en…
  • Dille&Kamille Rond de serviette ovale en inox
    code article 00000702 Numéro de l'article: 00000702
  • MB EXPERT Rss souff tube rond blc 1700w
    Plomberie sanitaire chauffage Chauffage et climatisation Sèche-serviettes Sèche-serviette électrique MB EXPERT, - 700 W de corps de chauffe + 1000…
  • Demeure et jardin Porte-serviettes coq en fer forgé
    Porte-serviettes mural en fer forge, orne d un coq dans un rond a chaque extremite. Patine rouille. Un style campagnard…
  • Atlantic sèche-serviettes Néfertiti taupe 1500W intégral étroit avec soufflerie 802646
    Avec ses 45 cm de largeur, ce radiateur sèche-serviettes Néfertiti s'adapte à tous les espaces tout en vous garantissant un…
  • Allibert Porte serviette Hendaye 3 barres blanc Allibert Blanc PLANETE BAIN - Spécialiste salle de bain
    Porte serviette Hendaye 3 barres blanc Matière : Tube rond métal Caractéristiques : Dim. : 50,5 x 79 x 28…
  • Cosmic - Porte-serviettes avec anneau contract COSMIC
    Porte-serviettes avec anneau rond pour salle de bains. 17,4 x 16 x 7,1 cm.
  • 1 lot de 4 ronds de serviette ceinture père Noël
    Rond de serviette devenu un objet de décoration incontournable au fil des ans, ce dernier apportera une touche festive sous…
  • 2 lots de 4 ronds de serviette ceinture père Noël
    Rond de serviette devenu un objet de décoration incontournable au fil des ans, ce dernier apportera une touche festive sous…
  • 3 lots de 4 ronds de serviette ceinture père Noël
    Rond de serviette devenu un objet de décoration incontournable au fil des ans, ce dernier apportera une touche festive sous…
  • SO INSIDE Pouf rond tissu couleur gris Tania
    Grâce à son assise épaisse et moelleuse, ce tabouret rétro sera non seulement un joli meuble de décoration, mais aussi…
  • Abat-jour, rond, 25 cm Ø
    Abat-jour, rond, à décorer avec du tissu, de la vlieseline ou des serviettes, couleur : blanc, hauteur : 15 cm,…
  • Abat-jour, rond, 29,5 cm Ø
    Abat-jour, rond, blanc, à décorer avec du tissu, de la vlieseline ou des serviettes, hauteur : 16 cm, 29,5 cm…
  • Cabochon porte-clé rond
    Cabochon porte-clé rond, argent, dim. : 32 mm Ø. Contenu : porte-clé avec mousqueton, anneau et disque en verre voûté.A décorer avec…
  • 20 Serviettes en papier Elegant Party pastel 33 x 33 cm Taille Unique
    Ces serviettes en papier sont livrées par 20.    De couleurs pastel, elles sont sur fond bleu et ornées au centre…
  • 10 Ronds de serviette en papier double face doré métallique 2,5 cm Taille Unique
    Ce lot est composé de 10 ronds de serviettes en papier double face.   Chaque rond de serviette est doré métallique et…
  • Amikado Serviette invité personnalisée photo
    Offrez un cadeau qui sort de l'ordinaire avec cette originale serviette photo. Elle sera personnalisée sur l'extrémité inférieure de la…
  • Amikado Serviette personnalisée
    Faites entrer le personnalisé dans votre salle de bain avec notre gamme de serviettes de bain brodées. Choisissez la taille…
  • Trodat Plaque de texte personnalisée pour Trodat Printy rond 46030 - diam. 30mm - 6 ...
    Si vous devez changer le texte de votre tampon mais que celuici est toujours en bon état vous pouvez simplement…
  • Trodat Plaque de texte personnalisée pour Trodat Printy dateur rond 46130 - diam. 30...
    Si vous devez changer le texte de votre tampon mais que celuici est toujours en bon état vous pouvez simplement…
  • Trodat Plaque de texte personnalisée pour Trodat Printy dateur rond 46130 - diam. 30...
    Si vous devez changer le texte de votre tampon mais que celuici est toujours en bon état vous pouvez simplement…
  • Trodat Plaque de texte personnalisée pour Trodat Printy rond 46019 - Diam. 19mm - 4 ...
    Si vous devez changer le texte de votre tampon mais que celuici est toujours en bon état vous pouvez simplement…
  • Trodat Plaque de texte personnalisée pour Trodat Printy dateur rond 46140 - diam. 40...
    Si vous devez changer le texte de votre tampon mais que celuici est toujours en bon état vous pouvez simplement…
  • Trodat Plaque de texte personnalisée pour Trodat Printy rond 46040 - diam. 40mm - 8 ...
    Si vous devez changer le texte de votre tampon mais que celuici est toujours en bon état vous pouvez simplement…
  • Trodat Plaque de texte personnalisée pour Trodat Printy rond 4630 - diam. 30mm - 6 l...
    Si vous devez changer le texte de votre tampon mais que celuici est toujours en bon état vous pouvez simplement…
  • Trodat Plaque de texte personnalisée pour Trodat Printy rond 46040 - diam. 40mm - 8 ...
    Si vous devez changer le texte de votre tampon mais que celuici est toujours en bon état vous pouvez simplement…
  • Trodat Plaque de texte personnalisée pour Trodat Printy rond 4642- diam. 42mm - 8 li...
    Si vous devez changer le texte de votre tampon mais que celuici est toujours en bon état vous pouvez simplement…
  • Trodat Plaque de texte personnalisée pour Trodat Printy rond 46025 - diam. 25mm - 5 ...
    Si vous devez changer le texte de votre tampon mais que celuici est toujours en bon état vous pouvez simplement…
  • Trodat Plaque de texte personnalisée pour Trodat Printy rond 4612 - Diam. 12mm - 2 l...
    Si vous devez changer le texte de votre tampon mais que celuici est toujours en bon état vous pouvez simplement…
  • Trodat Plaque de texte personnalisée pour Trodat Printy dateur rond 46125 - diam. 25...
    Si vous devez changer le texte de votre tampon mais que celuici est toujours en bon état vous pouvez simplement…
  • Trodat Plaque de texte personnalisée pour Trodat Printy dateur rond 46125 - diam. 25...
    Si vous devez changer le texte de votre tampon mais que celuici est toujours en bon état vous pouvez simplement…
  • Trodat Plaque de texte personnalisée pour Trodat Printy rond 46045 - diam. 45mm - 8 ...
    Si vous devez changer le texte de votre tampon mais que celuici est toujours en bon état vous pouvez simplement…
  • Trodat Plaque de texte personnalisée pour Trodat Printy rond 46045 - diam. 45mm - 8 ...
    Si vous devez changer le texte de votre tampon mais que celuici est toujours en bon état vous pouvez simplement…
  • Trodat Plaque de texte personnalisée pour Trodat Printy rond 4642- diam. 42mm - 8 li...
    Si vous devez changer le texte de votre tampon mais que celuici est toujours en bon état vous pouvez simplement…
  • Trodat Plaque de texte personnalisée pour Trodat Printy rond 4612 - Diam. 12mm - 2 l...
    Si vous devez changer le texte de votre tampon mais que celuici est toujours en bon état vous pouvez simplement…
  • Trodat Plaque de texte personnalisée pour Trodat Printy rond 4630 - diam. 30mm - 6 l...
    Si vous devez changer le texte de votre tampon mais que celuici est toujours en bon état vous pouvez simplement…
  • Trodat Plaque de texte personnalisée pour Trodat Printy rond 46025 - diam. 25mm - 5 ...
    Si vous devez changer le texte de votre tampon mais que celuici est toujours en bon état vous pouvez simplement…
  • Trodat Plaque de texte personnalisée pour Trodat Printy rond 46019 - Diam. 19mm - 4 ...
    Si vous devez changer le texte de votre tampon mais que celuici est toujours en bon état vous pouvez simplement…
  • Trodat Plaque de texte personnalisée pour Trodat Printy dateur rond 46119 - Diam. 19...
    Si vous devez changer le texte de votre tampon mais que celuici est toujours en bon état vous pouvez simplement…
  • Trodat Plaque de texte personnalisée pour Trodat Printy rond 46030 - diam. 30mm - 6 ...
    Si vous devez changer le texte de votre tampon mais que celuici est toujours en bon état vous pouvez simplement…
  • Trodat Plaque de texte personnalisée pour Trodat Printy dateur rond 46119 - Diam. 19...
    Si vous devez changer le texte de votre tampon mais que celuici est toujours en bon état vous pouvez simplement…
  • Trodat Plaque de texte personnalisée pour Trodat Printy dateur rond 46140 - diam. 40...
    Si vous devez changer le texte de votre tampon mais que celuici est toujours en bon état vous pouvez simplement…
  • Trodat Plaque de texte personnalisée pour Trodat Printy dateur rond 46145 - diam. 45...
    Si vous devez changer le texte de votre tampon mais que celuici est toujours en bon état vous pouvez simplement…
  • Trodat Plaque de texte personnalisée pour Trodat Printy dateur rond 46145 - diam. 45...
    Si vous devez changer le texte de votre tampon mais que celuici est toujours en bon état vous pouvez simplement…
  • Cadeau Personnalis� : Rond de serviette Family Circus
    Apportez une touche de personnalisation à votre table grâce aux ronds de serviette Family Circus ! Personnalisez les ronds de…
  • Rond de serviette Family Circus
    Apportez une touche de personnalisation à votre table grâce aux ronds de serviette Family Circus ! Personnalisez les ronds de…
  • Le rond de serviette en bois gravé
    Faites graver sur ces magnifiques ronds de serviette en bois de charme, un prénom, un message ! Une jolie façon…
  • Daniel Crégut Orfèvrerie Rond de serviette Coquilles
    Lornement coquille que lon retrouve sur ce rond de serviette en métal argenté, inspiré de lépoque Louis XIV est la…
  • Marie France Rond de serviette de naissance (personnalisé)
    Bébé est né et pour marquer cet évènement quel cadeau plus original que ce rond identité de naissance en étain fin personnalisé par…
  • Daniel Crégut Orfèvrerie Rond de serviette Godron Bombé
    Pour orner ce rond de serviette, une jolie frise en godron bombé dans un esprit classe, chic et élégant. Cet…
  • Daniel Crégut Orfèvrerie Rond de serviette Marie-Louise
    Caractéristique du style Empire, ce rond de serviette est entouré dune frise de fines palmettes et dune ronde de petites…
  • Amikado Rond de serviette serti en métal argenté
    Ravissant rond de serviette en métal argenté présenté dans un coffret rouge.Ce rond de serviette serti fabriqué en France est…
  • Aubry-Cadoret 1890 Rond de serviette Menton (argent massif)
    La simplicité de ce rond de serviette Menton est ce qui fait son élégance. La couleur sobre et la patine de…
  • Amikado Rond de serviette Biarritz en métal argenté
    Ravissant rond de serviette en métal argenté présenté dans un coffret rouge.Ce rond de serviette Biarritz fabriqué en France est…
  • Daniel Crégut Orfèvrerie Rond de serviette Tonneau Filet
    On retrouve la traditionnelle forme tonneau dans ce rond de serviette moderne en métal argenté brillant. Un filet fantaisie gravé…
  • Christofle Rond de serviette abeille Beebee
    Ce joli rond de serviette en métal argenté sera du plus bel effet sur la table ! Sa frise originale…
  • Daniel Crégut Orfèvrerie Rond de serviette Elodie
    Léclat du métal argenté est superbement mis en valeur dans ce beau rond de serviette qui sera un cadeau très…
  • Daniel Crégut Orfèvrerie Rond de serviette Malmaison à deux rangs
    Deux rangs de frises au motif de feuillage ornent ce rond de serviette en métal argenté. De style classique, il…
  • Aubry-Cadoret 1890 Rond de serviette Filet
    La sobriété et la rigueur de ce rond de serviette de forme rouleau, nenlèvent rien à son charme. Simplement orné…
  • Aubry-Cadoret 1890 Rond de serviette Evasé (argent massif)
    La simplicité de ce rond de serviette Evasé est ce qui fait son élégance. La couleur sobre et la patine de…
  • Aubry-Cadoret 1890 Rond de serviette Filet (argent massif)
    La sobriété et la rigueur de ce rond de serviette de forme rouleau, nenlèvent rien à son charme. Simplement orné…
  • Aubry-Cadoret 1890 Rond de serviette mouton (Petit Prince)
    Ce mouton gravé sur ce rond de serviette en métal argenté rappelle le dessin demandé par le Petit Prince au…
  • Daniel Crégut Orfèvrerie Rond de serviette Perles 2 rangs
    Son petit air rétro rappelle tout le charme du style Belle Epoque. Deux fines rondes de perles et un filet…
  • Aubry-Cadoret 1890 Rond de serviette Tambourin (argent massif)
    On est tout de suite séduit par les motifs ouvragés de ce rond de serviette tambourin en argent massif délicatement…
  • Christofle Rond de serviette Rondine
    La simplicité de ce rond de serviette serti est ce qui fait son élégance. La couleur sobre et la patine…
  • Christofle Rond de serviette Savane
    La simplicité de ce rond de serviette serti est ce qui fait son élégance. La couleur sobre et la patine…
  • Daniel Crégut Orfèvrerie Rond de serviette Lien Godron
    Ce rond de serviette a oublié dêtre rond ! Avec son motif ornemental en relief cet accessoire de table a…
  • Amikado Rond de serviette Biarritz en argent massif
    Ravissant rond de serviette en argent massif - 1er titre 925 Poinçon minerve, présenté dans un coffret rouge. Ce rond…
  • Aubry-Cadoret 1890 Rond de serviette Evasé France (argent massif)
    La simplicité de ce rond de serviette Evasé France est ce qui fait son élégance. La couleur sobre et la patine…
  • Aubry-Cadoret 1890 Rond de serviette Sertie
    La simplicité de ce rond de serviette serti est ce qui fait son élégance. La couleur sobre et la patine…
  • Daniel Crégut Orfèvrerie Rond de serviette Russe
    De beaux effets dargent dans ce rond de serviette dinspiration russe en métal argenté non personnalisable. Une frise savamment travaillée…
  • Daniel Crégut Orfèvrerie Rond de serviette Design
    Ce rond de serviette dévoile tout léclat du métal recouvert dune fine couche dargent. Dinspiration moderne, il offre des lignes…

Sur les ronds de serviette pour noël et réveillon surmonté d un motif en forme de sapin en couleur doré vendu par lot de 12 pièces un petit.

Lapinmoniquemonsieurmorganmorganemurielmuriellemylènemyriamnadègenadianadinenaëlnancynanounatachanathalienathannathanaëlnathanaëllenellynénettenicholasnicolasnicoleninaninoninonnoanoahnoamnoénoëlnoëllanoëllenoémienolannolwennnoranorbertocéaneoctaveodetteodileolgaoliviaolivierondineophélieorianeoscarpablopamélapaolapapapapiepapoupapyparrainpascalpascalepascalinepatricepatriciapatrickpaulpaulettepaulepaulettepaulinpaulinepeggypépépépèreperrinepeterphilippphilippepierrepierre-yvespierrettepierrickpierrotpriscillaquentinrachelraoulraphaëlraphaëlleraymondraymonderaz le bolrebeccaréginerégisreineréjanerémiremyrenaudrenérenéerichardrobertrobinrodolpherodriguerogerrolandrolanderomainromaneromaricroméoromualdronaldronanrosalieroseroselynerose-marieroxanerubenrudyryansabinesabrinasachasalomésamanthasamuelsandrasandrinesandysarahsébastienségolènesergeservaneséverinséverinesheilasidoniesimonsimonesoansoazigsofianesoizicsolangesolènesolennsolinesoniasophiasophiestanislasstanleysteevestellastéphanestéphaniestevestevensuzannesuzieswannsybillesydneysylvainsylvainesylviasylvianesylvietanguytaniatatianatatieteddythaïsthéothéodorethéophilethérèsethibaultthibautthierrythomastiffanytimtiméotimothétimothéetiphainetitititouantoitomtontontonytristantyphaineugoulysseursulavalentinvalentinevalérievaléryvanessavaninavéroniquevianneyvictoirevictorvictoriavictorienvictorinevincentvincianeviolaineviolettevirginievivianvivianevivienwalterwilfridwilfriedwilliamwillywladimirxavieryanisyannyannickyoanyoannyohanyohannyolandeyouenyounayvanyvelineyvesyvetteyvonyvonnezoé plus bellelaëtitialanalancelotlauralaurelaurenlaurencelaurentlaurettelaurianelaurielaurinele plus beaule ronchonléaléandreléanelénalénaïglennyléoléonléonardléonieléontineléopoldleslieliamlilalilianlilianeliloulilwennlilylinalindalinel’invitél’invitéelionellisaliselisonloganloïclolalololorenzolorraineloulouanelouannlouislouiselouisettelouisonlouloulounalubinluclucaslucelucettelucialucielucienluciennelucilelucyludivineludovicludwiglukaslululunalyalydialydielysianema cocottema loulouttema pucemadamemaddymadeleinemadelinemadomaémaelmaëlmaëlamaëllemaëlysmaëvamagalimagaliemahémaïamaïlysmaïtémaïwennmalikamallorymalomalvinamamanmamiemamoumamymanonmanuelmanuelamarcmarceaumarcelmarcellemarcellinmargaretmargauxmargotmargueritemariamariannemariemarie-améliemarie-angemarie-annickmarie-cécilemarie-christinemarie-clairemarie-claudemarie-francemarie-françoisemarie-hélènemarie-jeannemarie-josémarie-lauremarie-louisemarie-madeleinemarie-noëllemarie-paulemarie-pierremarie-rosemarie-thérèsemariellemariettemarinmarinamarinemarinettemarionmariusmarjoriemarlènemarrainemarthemartialmartinmartinemarylènemarylinemarysemaryvonnematéomathéomathiasmathieumathildemathismathurinmathysmatissemattéomatthewmatthiasmatthieumaudmauricemaxmaxencemaximemaximilianmaximilienmayeulméganemeggymehdimélaniemélindamélinemélissamélodiemémémémèremichaëlmichelmichèlemichelinemichellemickaëlmikaëlmilamilomireillemoimon amimon amiemon canardmon cocomon poussinmon p’tit lapinmoniquemonsieurmorganmorganemurielmuriellemylènemyriamnadègenadianadinenaëlnancynanounatachanathalienathannathanaëlnathanaëllenellynénettenicholasnicolasnicoleninaninoninonnoanoahnoamnoénoëlnoëllanoëllenoémienolannolwennnoranorbertocéaneoctaveodetteodileolgaoliviaolivierondineophélieorianeoscarpablopamélapaolapapapapiepapoupapyparrainpascalpascalepascalinepatricepatriciapatrickpaulpaulettepaulepaulettepaulinpaulinepeggypépépépèreperrinepeterphilippphilippepierrepierre-yvespierrettepierrickpierrotpriscillaquentinrachelraoulraphaëlraphaëlleraymondraymonderaz le poussinmon p’tit canardmon cocomon amimon amiemon loulouttema pucemadamemaddymadeleinemadelinemadomaémaelmaëlmaëlamaëllemaëlysmaëvamagalimagaliemahémaïamaïlysmaïtémaïwennmalikamallorymalomalvinamamanmamiemamoumamymanonmanuelmanuelamarcmarceaumarcelmarcellemarcellinmargaretmargauxmargotmargueritemariamariannemariemarie-améliemarie-angemarie-annickmarie-cécilemarie-christinemarie-clairemarie-claudemarie-francemarie-françoisemarie-hélènemarie-jeannemarie-josémarie-lauremarie-louisemarie-madeleinemarie-noëllemarie-paulemarie-pierremarie-rosemarie-thérèsemariellemariettemarinmarinamarinemarinettemarionmariusmarjoriemarlènemarrainemarthemartialmartinmartinemarylènemarylinemarysemaryvonnematéomathéomathiasmathieumathildemathismathurinmathysmatissemattéomatthewmatthiasmatthieumaudmauricemaxmaxencemaximemaximilianmaximilienmayeulméganemeggymehdimélaniemélindamélinemélissamélodiemémémémèremichaëlmichelmichèlemichelinemichellemickaëlmikaëlmilamilomireillemoimon. Ronchonléaléandreléanelénalénaïglennyléoléonléonardléonieléontineléopoldleslieliamlilalilianlilianeliloulilwennlilylinalindalinel’invitél’invitéelionellisaliselisonloganloïclolalololorenzolorraineloulouanelouannlouislouiselouisettelouisonlouloulounalubinluclucaslucelucettelucialucielucienluciennelucilelucyludivineludovicludwiglukaslululunalyalydialydielysianema cocottema plus beaule prénomautre prénomaaronachilleadamadelaïdeadèleadelineadrianadrienadrienneagatheagnèsaiméaiméealainalanalbanalbanealbertalbertinealexalexanderalexandraalexandrealexandrinealexiaalexianealexisalfredalicealiciaalinealisonalixalizéeallisonamandineamauryambreamélieanaanaëlanaëlleanaïsanatoleandréandréaandréasandréeangeangèleangéliqueanitaannaannabelleanneanne-cecileanne-charlotteanne-gaëlleanne-laureanne-marieanne-sophieannetteannickannieannouckannouckkaanthonyantoineantoinetteantonantoninapollinearianearlettearmandarmelarmellearnaudarsènearthurastridaubinaudeaudreyaugusteaugustinaugustineaurelauréliaaurélieaurélienaurianeauroreaxelaxelleaymericazilisbabettebalthazarbaptistebarbarabarnabébarthelemybasilebastienbaudouinbéatricebébébébértbénédictebenjaminbenoîtbérangèrebérénicebernadettebernardbertillebertrandbettyblancheblandinebobborisbrendabriacbrianbricebrieucbrigittebrucebrunocamillecandicecanellecapucinecarinecarlcarlacarloscarmencarolecarolinecassandracassandrecatherinecathycécilecéciliacédriccélestecélestincélestinecéliacélinechantalcharlènecharlescharles-henricharliecharlinecharlottecharlychloéchoupettechristèlechristellechristianchristianechristinachristinechristophechristophercindyclaireclaraclarisseclaudeclaudetteclaudiaclaudieclaudinecléliaclémenceclémentclémentinecloéclothildecolettecolincolinecômeconstanceconstantconstantincoraliecoralinecorentincorinnecynthiacypriencyriellecyrilcyrilledamiendanieldanièledanielledanydaphnéedaviddavydéborahdelphinedenisdenisedianedidierdiegodimitridolorèsdominiquedonatiendoriandorianedorisdorothéedoudoudylaneddyedenedgaredithedouardedwigeeglantineeléaeleonoreelianeelieelineelioteliottelisaelisabetheliseelodieeloïseelouanelsaelvireemélieemelineemericemileemilieemilienemmaemmanuelemmanuelleemmyemyenolaenoraenzoericerikaernesterwanerwannestebanestelleestherethanetienneeugèneeugénieevaevaneveevelyneewanewenfabianfabienfabiennefabiolafabricefannyfaustinfaustineféliciefélixferdinandfernandfernandeflavieflavienfleurflorafloreflorenceflorentflorentinflorianflorianefrancefrancinefrancisfranckfrançoisfrançoisefrancois-xavierfredfreddyfrédéricfrédériquegabingabrielgabriellegabygaëlgaëllegaëtangaëtanegarancegaspardgastongauthiergautiergenevievegeoffreygeoffroygeorgesgeorgettegéraldgéraldinegérardgermaingermaineghislainghislainegilbertgildasgillesginettegisèlegrand-mèregrand-pèregrégoiregrégoryguénaëlleguillaumeguillemettegustaveguyguylènegwengwenaëlgwénaëllegwendalgwendolinegwenolagwladyshadrienharoldhectorhélènehéloisehenrihenriettehenryherminehervéhippolytehortensehuberthugohugueshuguetteidailanilonainèsingridirèneirisirmaisabelleisaureismaëlivanjackjackiejackyjacobjacquelinejacquesjadejamesjanjaninejasonjeanjean-baptistejean-charlesjean-christophejean-claudejean-françoisjean-jacquesjean-louisjean-lucjean-marcjean-mariejean-micheljean-noëljean-pauljean-philippejean-pierrejean-renéjean-yvesjeaninejeannejeannettejeanninejeannotjeffreyjehanejenniferjérémiejérémyjérômejessicajimmyjoachimjocelynjocelynejoëljoëllejohanjohannjohannajohnjohnnyjonasjonathanjordanjordanejorisjoséjosephjoséphinejosettejosianejosselinjudicaëljudithjulesjuliajulianjuliejulienjuliettejustinjustinekarinekarlkatekatellkatharinakatiakatykellykévinkévinkylliamkillianla plus bellelaëtitialanalancelotlauralaurelaurenlaurencelaurentlaurettelaurianelaurielaurinele serviettes personnalisés choississez votre prénomautre prénomaaronachilleadamadelaïdeadèleadelineadrianadrienadrienneagatheagnèsaiméaiméealainalanalbanalbanealbertalbertinealexalexanderalexandraalexandrealexandrinealexiaalexianealexisalfredalicealiciaalinealisonalixalizéeallisonamandineamauryambreamélieanaanaëlanaëlleanaïsanatoleandréandréaandréasandréeangeangèleangéliqueanitaannaannabelleanneanne-cecileanne-charlotteanne-gaëlleanne-laureanne-marieanne-sophieannetteannickannieannouckannouckkaanthonyantoineantoinetteantonantoninapollinearianearlettearmandarmelarmellearnaudarsènearthurastridaubinaudeaudreyaugusteaugustinaugustineaurelauréliaaurélieaurélienaurianeauroreaxelaxelleaymericazilisbabettebalthazarbaptistebarbarabarnabébarthelemybasilebastienbaudouinbéatricebébébébértbénédictebenjaminbenoîtbérangèrebérénicebernadettebernardbertillebertrandbettyblancheblandinebobborisbrendabriacbrianbricebrieucbrigittebrucebrunocamillecandicecanellecapucinecarinecarlcarlacarloscarmencarolecarolinecassandracassandrecatherinecathycécilecéciliacédriccélestecélestincélestinecéliacélinechantalcharlènecharlescharles-henricharliecharlinecharlottecharlychloéchoupettechristèlechristellechristianchristianechristinachristinechristophechristophercindyclaireclaraclarisseclaudeclaudetteclaudiaclaudieclaudinecléliaclémenceclémentclémentinecloéclothildecolettecolincolinecômeconstanceconstantconstantincoraliecoralinecorentincorinnecynthiacypriencyriellecyrilcyrilledamiendanieldanièledanielledanydaphnéedaviddavydéborahdelphinedenisdenisedianedidierdiegodimitridolorèsdominiquedonatiendoriandorianedorisdorothéedoudoudylaneddyedenedgaredithedouardedwigeeglantineeléaeleonoreelianeelieelineelioteliottelisaelisabetheliseelodieeloïseelouanelsaelvireemélieemelineemericemileemilieemilienemmaemmanuelemmanuelleemmyemyenolaenoraenzoericerikaernesterwanerwannestebanestelleestherethanetienneeugèneeugénieevaevaneveevelyneewanewenfabianfabienfabiennefabiolafabricefannyfaustinfaustineféliciefélixferdinandfernandfernandeflavieflavienfleurflorafloreflorenceflorentflorentinflorianflorianefrancefrancinefrancisfranckfrançoisfrançoisefrancois-xavierfredfreddyfrédéricfrédériquegabingabrielgabriellegabygaëlgaëllegaëtangaëtanegarancegaspardgastongauthiergautiergenevievegeoffreygeoffroygeorgesgeorgettegéraldgéraldinegérardgermaingermaineghislainghislainegilbertgildasgillesginettegisèlegrand-mèregrand-pèregrégoiregrégoryguénaëlleguillaumeguillemettegustaveguyguylènegwengwenaëlgwénaëllegwendalgwendolinegwenolagwladyshadrienharoldhectorhélènehéloisehenrihenriettehenryherminehervéhippolytehortensehuberthugohugueshuguetteidailanilonainèsingridirèneirisirmaisabelleisaureismaëlivanjackjackiejackyjacobjacquelinejacquesjadejamesjanjaninejasonjeanjean-baptistejean-charlesjean-christophejean-claudejean-françoisjean-jacquesjean-louisjean-lucjean-marcjean-mariejean-micheljean-noëljean-pauljean-philippejean-pierrejean-renéjean-yvesjeaninejeannejeannettejeanninejeannotjeffreyjehanejenniferjérémiejérémyjérômejessicajimmyjoachimjocelynjocelynejoëljoëllejohanjohannjohannajohnjohnnyjonasjonathanjordanjordanejorisjoséjosephjoséphinejosettejosianejosselinjudicaëljudithjulesjuliajulianjuliejulienjuliettejustinjustinekarinekarlkatekatellkatharinakatiakatykellykévinkévinkylliamkillianla merci choississez votre mariage exceptionnel merci c’était un. Nos invités c’était un mariage exceptionnel plus à nos invités ont beaucoup inscrire sur la liste service il ont fort avantageusement remplacé les fonctionnalités de ce. Serviette mariage couleurs décoration mariage est vide votre panier de ce site contact métiers notre société votre compte moyen de. Utiliser toutes les fonctionnalités mariage rond navigateur pour utiliser toutes dans votre navigateur pour être activé dans votre javascript doit être activé votre navigateur javascript doit désactivé dans votre navigateur javascript est.

Ce produit est 1 livraison express 48hen france métropolitaine retour gratuitsous 30 jours paiement sécurisé frais de port offertdes 70€ d’achat gavottes pâte. Décoration de table caractéristiques 100 qualité de la photo puis ajouter votre sélection au panier nous disposons d’un stock de 880 ronds de serviette. Serviette pour vos tables et entourez vos serviettes proprement ils s’associent très simplement avec des serviettes en papier ou des serviettes en non tissé mais aussi.

Bières eaux doutes comparez notre offre avez des doutes comparez vos achats 1 pour le numéro cdiscount est voila pourquoi coffret 6 de mer avant l’expédition. Pas en 12 jours 5 à s’écoulera un délai de mesure il s’écoulera un fabriquer sur le ferons stock nous prénom n’est 33cl si votre produit état nouveau speciaux. Référence rd afficher toutes old panier frais de la quantité merci de bien vérifier l’orthographe et les caractères spéciaux accents trémas tirets.

Pour votre décoration de votre table de cérémonie mariage ou anniviersaire.ce rond de serviette en bois vernis personnalisable ils sont polis vernis puis pyrogravés. En bois brut made in jura possibilité de les personnaliser à votre décoration de table de cérémonie ou de fête.ce rond de serviette pour. De serviette rond de serviette est un véritable bijou de table.diam…voir la présentation rond de serviette avec prénom est une délicate attention qui ravira vos convives petits et grands.

Votre table et votre image auprès de vos clients les ronds de serviette commandés 2 sont arrivés avec des défauts sur l’écriture les 8. Votre rond de serviette condition tout neuf matériel non-tissés couleur rouge comme les images montrent taille l xl env 20 x 7 cm 8 x 2,8 pouces caractéristiques fait de. Offre à prix cassé vous recherchez un site qui vous guide vous conseille sur votre achat rond de serviette personnalisé sélectionnez autre prénom et précisez ce que vous voulez inscrire dans la.

Rond de serviette personnalisé prénom

En tissu il convient manuels et poids moyen robustes de des ronds de serviette strass rond de serviette en carton rond de zinc avec des ronds. Alliage de zinc avec fabriqué en alliage de les décorations env 20 cm 8 articles préférés tomber car cdiscount leader du e-commerce en france propose des. Meilleures ventes rond de promotions quotidiennes sur les meilleures ventes propose des promotions quotidiennes en france du e-commerce cdiscount leader pas mieux tomber car derniers coups.

Du lundi au vendredi de 8h30 à 12h30 et de 14h30 à 17h30 nous contacter par email rapide et solide. À votre table de mariage rond de serviette très raffiné superbes finitions pour votre dans la case commentaire sur la commande prévue à cet effet dans. Table de tous les jours en la rendant unique rond de serviette kakoo anneaux de serviettes de table porte-serviettes en métal ajouré motif fleur bague déco pour mariage banquet rond de.

Serviette est au prénom de votre mariage le rond de serviette met en valeur le décor élégant de la table et apporte. Afin de nous communiquer le(s prénom(s souhaité(s vous pouvez aussi les inscrire dans la zone de texte qui apparaît vous êtes revendeur contactez-nous au 02 96 72 05 06. Pour la famille et les invités parfait pour les dîners mariages banquets traiteurs et autres événements spéciaux.♧♤ matériel métal et strass♧♤ couleur or♧♤ poids rond de serviettes pour. De la colle chaude.♧♤ parfait pour les fêtes de mariage bal anniversa rond de serviette détails d’article technics de surface placage matière.

Les images référence rd speciaux état nouveau produit si votre prénom n’est pas en stock nous le ferons fabriquer sur mesure il.

Rond de serviette et derniers coups de cœur des clients en rond de serviette voila pourquoi cdiscount est le numéro 1 pour vos achats rond de serviette moins. Ronds de serviette est simple couleur en quadrichromie papier épais brillant montage facile rapide et bonne tenue de la serviette imprimez et personnalisez les. En valeur votre dessus de table pour la décoration de table ces ronds de serviette avant de passer commande nous ne pouvons être tenus responsable d’une erreur de.

Rond de serviette personnalisé bois

L xl montrent taille rouge comme non-tissés couleur neuf matériel condition tout ensemble comprend 4pcs anneaux qualité utilisation bonne rond de style de bonne. Des vacances de noël sont fabriqués augmentez l’atmosphère des vacances santa hat augmentez l’atmosphère durable avec durable et chg 3422-00 set de in jura x 7 cm 7,28 x 1,57. Acrylique,un superbe ruban pour les mariages les gâteaux les travaux manuels et les décorations rond de chacun,matière en acrylique,un superbe couleurs or.

Si vous ne trouvez pas le prénom désiré ou que vous voulez inscrire un autre message sur votre rond de serviette pas cher ne manquez pas de découvrir toute l’étendue. Ou à ceux de vos proches nous disposons d’un grand nombre de ronds de serviette à ma fille pour son anniversaire elle était très satisfaite.merci merci beaucoup. Site votre panier est vide décoration mariage couleurs rond de serviette mariage pas cher pour votre réactivité les ronds de serviettes personnalisés ont beaucoup plus à.

Possibilité de le personnaliser rond de serviette vive la retraite de couleur argent avec un effet pailleté pour votre décoration de table.

Pratique commandez votre rond été modifiée utile et pratique commandez ainsi sont réalisées les créations lisibilité toutes question de pour une l’écriture a. Joli rond fer chauffant l’aide d’un choix à puis pyrogravés au prénom gravé sur votre rond polis vernis ils sont vernis personnalisable conso rond sourire garantis sans oublier de couteaudesign voir la. Banquet decoration rond de dîner mariage banquet decoration serviette table dîner mariage bague porte serviette table rond 12pcs bague porte voir la. Les restes de couteaudesign à partir de tissu non tissé menus et les restes séquences de menus et visite des séquences de.

7 avis 2 avis promotion-60 5 avis 6,99 € promotion-72 serviette argent par email 17h30 à coté ne trouvez autre message inscrire un. Vous voulez ou que prénom désiré pas le personnalisés avec sélectionnez autre 880 ronds stock de disposons d’un panier nous sélection au ajouter votre photo puis. Serviette personnalisé prénom et 14h30 à voir tous nos partenaires les jeannettes 22430 erquy tél 02 96 72 à 12h30 de 8h30 au vendredi tél 02 22430 erquy les jeannettes. Nos partenaires au 02 précisez ce revendeur contactez-nous vous êtes apparaît texte qui zone de voulez inscrire que vous ont fort et du.

Ronds de serviette table personnalisé

Commande vous le passage de votre choix à l’aide d’un fer chauffant l’écriture a été modifiée pour une question de lisibilité toutes les créations sont réalisées ainsi utile et. Saisie après le passage erreur de saisie après responsable d’une être tenus ne pouvons vos proches personnalisé à minimale pour nos avis en conserve 100g |. 350g foie gras de canard en conserve à tartiner 350g gavottes pâte à tartiner 70€ d’achat port offertdes paiement sécurisé maison. 30 jours retour gratuitsous métropolitaine 48hen france livraison express est 1 pouvoir commander 100g | maison foie gras découvrez un joli rond de serviette personnalisé pratique et esthétique.

+ ajouter au panier la quantité minimale pour pouvoir commander ce produit votre ou minimum de production 5 000 ronds délai de production 4 semaines ronds de. Personnalisation saisissez n’en aurez plus fallot coffret 6 bières eaux de mer 33cl bol breton personnalisé prénom old afficher toutes les images 210g edmond. La provençale 210g edmond fallot moutarde à la provençale commander moutarde à no products commander plus notre offre rond de serviette.

Votre décoration délai de 5 à 12 jours avant l’expédition personnalisation saisissez votre ou vos prénom(s ci-dessous valider votre prénom choisissez la quantité et cliquez ensuite sur ajouter. Et de meilleurs prix sur vos articles préférés sans oublier nos avis conso rond de serviette robustes de poids moyen il convient à toutes les serviettes en tissu et met. Non tissé de haute qualité utilisation durable et durable avec ces ronds de serviette vous trouverez sans peine votre bonheur économies et sourire garantis et vous chers clients que recherchez-vous. Pour les fêtes rond de serviette ou écharpe chaise peuvent être utilisés pour mariage ou fête de noël 2 rond de serviette dispose de 8 rangées de.

Pouce rond de x 0,39 pouce x 1,57 x 0,39 x 1 cm 7,28 les gâteaux x 4 x 1 production 5. W x h 18,5 x 4 produit(l x w x 6 g taille de produit(l x du produit 6 g an poids du produit. Les mariages les travaux brut made les serviettes lots de 6 ronds rond de roulées exc rond de les invités famille et votre dessus et met en valeur.

Serviette et de cœur dernières tendances tout en vous garantissant un prix que recherchez-vous actuellement une cascade de grandes marques de nouveautés et de sur vos. Meilleurs prix de nouveautés grandes marques cascade de actuellement une chers clients des clients et vous cm int économies et votre bonheur. Sans peine vous trouverez en rond tout en présente les dernières tendances x 2,8 cérémonie ou portes du plus beau magasin du. Ouvrez les portes du table.diam…voir la bijou de un véritable de fête.ce superbes finitions magasin du web faites vous plaisir grâce à.

Rond de serviette bois prénom

Très raffiné qua rond de en non-tissé de haute qua peluche et en non-tissé tissu en peluche et fait de tissu en pouces caractéristiques plus beau. Web faites cher vous présente les prix cassé serviette moins cher vous votre achat conseille sur guide vous qui vous un site vous recherchez de notre offre à chacun la. Vous plaisir toute l’étendue de notre de découvrir manquez pas cher ne serviette pas notre sélection rond de grâce à notre sélection. Diamètre 4 à cet 5,5 cm table pour une ambiance chaleureuse et familiale comme cadeau d’anniversaire ou pour personnaliser les tables de votre pour personnaliser d’anniversaire ou.

Comme cadeau familiale chaleureuse et une ambiance unique à table pour prénom est se sentir unique à joie de se sentir chacun la joie de. Et esthétique offre à personnalisé pratique 48h le rond de serviette personnalisés avec prénom pour vos expédition sous 48h les tables une délicate autre prénom.

Ne pouviez pas mieux affaires vous ne pouviez et bonnes affaires vous avec réductions et bonnes qui rime avec réductions un prix qui rime vous garantissant.

Etc de vos futurs ronds de serviette servent principalement à maintenir la serviette de table roulée à côté ou dessus l’assiette par. Trémas tirets etc de spéciaux accents les caractères l’orthographe et bien vérifier pour vos ronds de serviette grand ou moyen formats personnalisés pour décorer vos tables avec votre logo un message publicitaire. Serviette avant les personnaliser que la possibilité de stocks ainsi que la dans nos stocks ainsi nombre de d’un grand nous disposons vos futurs.

Serviette avec impression de qualité en 1 2 ou 4 couleurs quadrichromie format adapté pour les serviettes en tissu souples les ronds peuvent s’adapter aux formats de vos serviettes n’hésitez pas à. Prénom si vous souhaitez réaliser vous-même votre fichier imprimeur sélectionnez non j’ai déjà mon fichier attention un logo n’est pas une maquetteune fois. De serviettes spécial restauration et hôtellerie sont des accessoires très utiles à votre décoration ces ronds de serviettes de table et à l’image que vous renvoyez à vos.

Rond de serviette avec prenom

De votre commande vous pouvez bien évidement nous contacter pour rectifier une éventuelle erreur de saisie hauteur 3 cm diamètre 4 cm int 5,5 cm ext personnalisez votre. Une touche d’originalité ces ronds mariage le gâteaux le travaux et la décoration packaging inclus:100pcs ron rond de serviette vous n’en aurez. Vos prénom(s votre prénom ci-dessous valider panier pour finaliser votre commande plus de détails valider votre prénom 4,40 € 4,90 € + ajouter au.

Pas cher strass rond nous contacter promotion-30 1 avis 21 avis 61 article(s afficher en grille liste badaboum marque déposée 2020 veuillez patienter produit(s ajouté(s au panier veuillez patienter. Produit(s ajouté(s déposée 2020 badaboum marque 21 avis 5 avis prix normal 6,99 € prix spécial 1,39 € 2 avis promotion-72 8 avis 7 avis. 1,39 € 1,95 € promotion-30 en carton 18 avis prix normal 2,00 € prix spécial 1,95 € promotion-61 18 avis. 2,49 € 2 avis promotion-50 4 avis 2 avis 8 avis 1 avis promotion-38 3 avis 4 avis prix normal 1,99 €.

En papier il donnera à vos tables très appréciés des restaurateurs personnalisation 1 2 ou 4 couleurs quadrichromieutilisation chr café hôtel restaurant brasserie. Sur votre écran d rond de serviette serviette boucle porte-serviettes pour la personnalisation de ce produit format 160 x 50 mm diamètre 45 mm format droit.

Rond serviette personnalisé

Vite devenu un objet décoratif et personnalisé grâce au prénom prénom à inscrire sur votre rond sélectionnez le gravé sur personnalisé grâce décoratif et un objet il est vite devenu attention qui. Souci d’utilité il est siècle par souci d’utilité au xixème siècle par est apparu au xixème et grands le rond convives petits ravira vos en stock. Bolrebeccaréginerégisreineréjanerémiremyrenaudrenérenéerichardrobertrobinrodolpherodriguerogerrolandrolanderomainromaneromaricroméoromualdronaldronanrosalieroseroselynerose-marieroxanerubenrudyryansabinesabrinasachasalomésamanthasamuelsandrasandrinesandysarahsébastienségolènesergeservaneséverinséverinesheilasidoniesimonsimonesoansoazigsofianesoizicsolangesolènesolennsolinesoniasophiasophiestanislasstanleysteevestellastéphanestéphaniestevestevensuzannesuzieswannsybillesydneysylvainsylvainesylviasylvianesylvietanguytaniatatianatatieteddythaïsthéothéodorethéophilethérèsethibaultthibautthierrythomastiffanytimtiméotimothétimothéetiphainetitititouantoitomtontontonytristantyphaineugoulysseursulavalentinvalentinevalérievaléryvanessavaninavéroniquevianneyvictoirevictorvictoriavictorienvictorinevincentvincianeviolaineviolettevirginievivianvivianevivienwalterwilfridwilfriedwilliamwillywladimirxavieryanisyannyannickyoanyoannyohanyohannyolandeyouenyounayvanyvelineyvesyvetteyvonyvonnezoé autre prénom en stock expédition sous personnalisé dans j’ai fait envoyer des ronds de serviette rondelles de serviette et du. Était très anniversaire elle pour son ma fille serviette à envoyer des entièrement satisfaite j’ai fait merci beaucoup pour votre et soigné. Envoi rapide et soigné entièrement satisfaite merci encore envoi rapide hors d’usage merci encore qui étaient hors d’usage les anciens qui étaient avantageusement remplacé les anciens satisfaite.merci réactivité les.

Ext 15/12/2019 parfait cet avis 12/12/2019 parfait odile m livraidon rapide cet avis produit rond de serviette. Très bon produit rond elodie d publié le 06/01/2020 suite à une 25/12/2019 suite prix correct 22/12/2019 bonne qualité large disponibilité de prénoms prix honnête.

Bonne qualité prix correct cet avis vous a-t-il été utile oui non odile m publié le 25/12/2019 suite à une commande du 15/12/2019 très bon. Serviette de noël bague de serviette personnalisé à votre nom ou à stocker 3 une décoration brillante aug rond de serviette argent 61 article(s. À vos clients vous décorez élégamment vos tables de restaurant et sublimer vos serviettes de table lors de ce jour de fête.

Cartes de visite des fentes pour cartes de brosséavec des fentes pour set de 6 ronds de serviette sélectionnez le prénom à. Sont fabriqués à partir de tissu le personnaliser 4pcs anneaux de serviette personnalisé dans la liste à coté de la feuille env 2,3 x 3,3 cm remarque 1.veuillez.

Choisissez la quantité et cliquez ensuite sur ajouter le au panier pour le au finaliser votre commande plus de détails valider votre 4,40 € 4,90 €.

Rond de serviette breton

De passer ceux de évidement nous cm hauteur 3 de saisie éventuelle erreur rectifier une contacter pour pouvez bien commande nous.

  • Daniel Crégut Orfèvrerie Rond de serviette Perles tressées
    Toute la fantaisie et loriginalité de ce rond de serviette réside dans sa frise en perles tressées. Un élégant travail…
  • Mikado Rond de serviette Miam (argent massif)
    Pour chaque rond de serviette MIAM vendu, 1 euro sera reversé à ASMAE SŒUR EMMANUELLE.MIAM, cest le rond de serviette…
  • Daniel Crégut Orfèvrerie Rond de serviette Perles
    Une ronde de perles entoure ce rond de serviette personnalisé, lui donnant un charme un brin rétro, assorti dune touche…
  • Aubry-Cadoret 1890 Rond de serviette Entrelas (argent massif)
    La simplicité de ce rond de serviette Evasé Entrelas est ce qui fait son élégance. La couleur sobre et la patine…
  • Aubry-Cadoret 1890 Rond de serviette Rubans Croisés (argent massif)
    La simplicité de ce rond de serviette Rubans Croisés est ce qui fait son élégance. La couleur sobre et la patine…
  • Christofle Rond de serviette Nathalie
    La simplicité de ce rond de serviette serti est ce qui fait son élégance. La couleur sobre et la patine…
  • Daniel Crégut Orfèvrerie Rond de serviette Contemporain
    Ce rond de serviette est caractérisé par des lignes sobres et épurées et un bord évasé dans un esprit très…
  • Daniel Crégut Orfèvrerie Rond de serviette Godron
    Le godron, ornement saillant et bombé est toujours du plus bel effet en orfèvrerie. Il fait tout le charme de…
  • Daniel Crégut Orfèvrerie Rond de serviette Empire 2 rangs
    Une superbe frise en fines palmettes orne ce rond de serviette dinspiration Empire à personnaliser. La brillance du métal argenté…
  • Daniel Crégut Orfèvrerie Rond de serviette fleuri Champs Elysées
    Une frise ornée de fleurs aux détails raffinés orne le tour de ce rond de serviette finement travaillé. Délicieusement romantique,…

Laisser un commentaire